PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID cra_locus_33_iso_1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Gentianales; Apocynaceae; Rauvolfioideae; Vinceae; Catharanthinae; Catharanthus
Family MYB_related
Protein Properties Length: 109aa    MW: 12600.9 Da    PI: 10.1497
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
cra_locus_33_iso_1genomeMPGR-
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding50.45.1e-161461148
                                       TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
                    Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                                       +g+WT+eEd++l+  +   G  +W+++++  g+ R++k+c++rw +yl
  cra_locus_33_iso_1_len_1019_ver_3 14 KGPWTAEEDKKLISFILTNGQCCWRAVPKLAGLLRCGKSCRLRWTNYL 61
                                       79******************************99************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.602.8E-21563IPR009057Homeodomain-like
PROSITE profilePS5129419.723965IPR017930Myb domain
SMARTSM007173.3E-121363IPR001005SANT/Myb domain
PfamPF002494.0E-151461IPR001005SANT/Myb domain
SuperFamilySSF466891.92E-191589IPR009057Homeodomain-like
CDDcd001674.63E-91661No hitNo description
Gene3DG3DSA:1.10.10.603.4E-66489IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009737Biological Processresponse to abscisic acid
GO:2000652Biological Processregulation of secondary cell wall biogenesis
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 109 aa     Download sequence    Send to blast
MGRQPCCDKV GLKKGPWTAE EDKKLISFIL TNGQCCWRAV PKLAGLLRCG KSCRLRWTNY  60
LRPDLKRGLL SEYEEKMVID LHAQLGNRFF SSLHQTIKKC KKQEKIYGV
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A2e-151289581B-MYB
1h8a_C4e-15128925101MYB TRANSFORMING PROTEIN
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00513DAPTransfer from AT5G16600Download
Motif logo
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003519327.13e-62PREDICTED: protein ODORANT1-like
SwissprotQ50EX63e-56ODO1_PETHY; Protein ODORANT1
TrEMBLA0A0B2S2X23e-62A0A0B2S2X2_GLYSO; Protein ODORANT1
TrEMBLI1JHW13e-62I1JHW1_SOYBN; MYB/HD-like transcription factor
STRINGGLYMA02G41180.18e-62(Glycine max)